Accéder au contenu
Merck
Toutes les photos(1)

Documents

SAB1405525

Sigma-Aldrich

Anti-TSPO antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

BZRP, DBI, IBP, MBR, PBR, PKBS, PTBR, TSPO Antibody - Anti-TSPO antibody produced in mouse, Tspo Antibody, mDRC, pk18

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~18.8 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

BC001110.2

Numéro d'accès UniProt

P30536

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TSPO(706)

Catégories apparentées

Description générale

Translocator protein (TSPO) contains five α helices. The TSPO gene is mapped to human chromosome 22q13.2. It is expressed in activated microglia.

Immunogène

TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.

Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)

Actions biochimiques/physiologiques

Translocator protein (TSPO) serves as a marker for microglial activation. The levels of TSPO are elevated in multiple sclerosis, Huntington′s disease (HD), and brain ischemia as well as in gliomas. TSPO functions as a key target for understanding neuroinflammation and has applications in positron emission tomography (PET) imaging. It also binds to cholesterol. The TSPO gene polymorphism may be associated with the pathophysiology of panic attacks, bipolar disorder, and anxiety. Together with voltage-dependent anion channel (VDAC), TSPO regulates terminal erythropoiesis as well as autophagy in mitochondria.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Laura Airas et al.
Clinical and translational imaging, 3, 461-473 (2015-01-01)
Conventional MR imaging (MRI) techniques form the cornerstone of multiple sclerosis (MS) diagnostics and clinical follow-up today. MRI is sensitive in demonstrating focal inflammatory lesions and diffuse atrophy. However, especially in progressive MS, there is increasingly widespread diffuse pathology also
Hien T T Lai et al.
Molecules (Basel, Switzerland), 26(5) (2021-03-04)
The translocator protein (TSPO) is a 18kDa transmembrane protein, ubiquitously present in human mitochondria. It is overexpressed in tumor cells and at the sites of neuroinflammation, thus representing an important biomarker, as well as a promising drug target. In mammalian
Biljana Musicki et al.
Journal of cellular physiology, 236(4), 3073-3082 (2020-09-26)
Priapism, a prolonged penile erection in the absence of sexual arousal, is common among patients with sickle cell disease (SCD). Hypogonadism is also common in patients with SCD. While the administration of exogenous testosterone reverses hypogonadism, it is contraceptive. We
Martina Moras et al.
International journal of molecular sciences, 21(23) (2020-12-03)
Translocator protein (TSPO) and voltage dependent anion channels (VDAC) are two proteins forming a macromolecular complex in the outer mitochondrial membrane that is involved in pleiotropic functions. Specifically, these proteins were described to regulate the clearance of damaged mitochondria by

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique