Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2102648

Sigma-Aldrich

Anti-UHRF2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-DKFZp434B0920, Anti-DKFZp686G0837, Anti-MGC33463, Anti-NIRF, Anti-Ubiquitin-like, containing PHD and RING finger domains, 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 356.00

CHF 356.00


Spedizione prevista il31 marzo 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 356.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41
Coniugato:
unconjugated
application:
WB
Clone:
polyclonal
Reattività contro le specie:
guinea pig, horse, rabbit, human, mouse, dog, bovine, rat
citations:
4
tecniche:
western blot: suitable

CHF 356.00


Spedizione prevista il31 marzo 2025


Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

90 kDa

Reattività contro le specie

guinea pig, horse, rabbit, human, mouse, dog, bovine, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... UHRF2(115426)

Descrizione generale

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) belongs to the ubiquitin plant homeodomain RING finger (UHRF) family. The gene is located on human chromosome 9p24.1. The protein consists of ubiquitin-like (UBL) domain, tandem tudor domain (TTD), plant homeodomain (PHD) finger domain, SET and RING associated (SRA) domain and RING finger domain.

Immunogeno

Synthetic peptide directed towards the middle region of human UHRF2

Azioni biochim/fisiol

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
UHRF2 is overexpressed in colorectal cancer cells and functions as an oncogene in breast cancer cells. UHRF2 domains are required for the regulation of cell cycle network, epigenetic system and UPS (ubiquitin proteasome system). The protein plays an important role in the nuclear degradation of polyglutamine aggregates. UHRF2 is involved in the DNA damage repair of aortic vascular smooth muscle cells.

Sequenza

Synthetic peptide located within the following region: NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

UHRF2 mRNA expression is low in malignant glioma but silencing inhibits the growth of U251 glioma cells in vitro
Wu TF, et al.
Asian Pacific Journal of Cancer Prevention, 13(10), 5137-5142 (2012)
Ubiquitin-like with PHD and ring finger domains 2 is a predictor of survival and a potential therapeutic target in colon cancer
Lu S, et al.
Oncology Reports, 31(4), 1802-1810 (2014)
Intra-nuclear degradation of polyglutamine aggregates by the ubiquitin proteasome system
Iwata A, et al.
The Journal of Biological Chemistry (2009)
Uhrf2 is important for DNA damage response in vascular smooth muscle cells
Luo T, et al.
Biochemical and Biophysical Research Communications, 441(1), 65-70 (2013)

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.