Passa al contenuto
Merck
Tutte le immagini(2)

Documenti

AV44970

Sigma-Aldrich

Anti-CLCC1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Chloride channel CLIC-like 1, Anti-KIAA0761, Anti-MCLC, Anti-RP11-475E11.6

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

61 kDa

Reattività contro le specie

dog, human, rabbit, mouse, pig, rat, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_001041675

N° accesso UniProt

Q96S66

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... CLCC1(23155)

Immunogeno

Synthetic peptide directed towards the N terminal region of human CLCC1

Applicazioni

Anti-CLCC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Azioni biochim/fisiol

Chloride channel CLIC-like 1 (CLCC1; Mid-1 related chloride channel, MCLC) belongs to the family of chloride channels present at the plasma membrane and membranes of intracellular compartments. They are involved in the regulation of cell volume and acidification of intracellular compartments. Chloride channels may modulate cell growth and apoptosis. CLCC1 is expressed in membranes of endoplasmic reticulum, Golgi apparatus, and nucleus.

Sequenza

Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Xinhua Li et al.
Annual review of physiology, 64, 609-633 (2002-02-05)
Hepatocytes possess chloride channels at the plasma membrane and in multiple intracellular compartments. These channels are required for cell volume regulation and acidification of intracellular organelles. Evidence also supports a role of chloride channels in modulation of apoptosis and cell
M Nagasawa et al.
The Journal of biological chemistry, 276(23), 20413-20418 (2001-03-30)
MID-1 is a Saccharomyces cerevisiae gene encoding a stretch-activated channel. Using MID-1 as a molecular probe, we isolated rat cDNA encoding a protein with four putative transmembrane domains. This gene encoded a protein of 541 amino acids. We also cloned

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.