AV44660

Anti-LRRC26 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-bA350O14.10
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 37 kDa
• Reattività contro le specie: dog, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001013675
• N° accesso UniProt: Q2I0M4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... LRRC26(389816)

Descrizione

Descrizione generale

Leucine-rich repeat (LRR)-containing protein 26 (LRRC26) functions as an auxiliary protein that complexes with and modulates the activation requirements of large-conductance, voltage- and calcium-activated potassium (BK, or K(Ca)1.1) and alkaline activated Slo channels. LRRC26 modulates the gating of a BK channel by enhancing the allosteric coupling between voltage-sensor activation and the channel′s closed-open transition.

Specificità

Anti-LRRC26 polyclonal antibody reacts with canine and human leucine-rich repeat (LRR)-containing protein 26 proteins.

Immunogeno

Synthetic peptide directed towards the middle region of human LRRC26

Applicazioni

Anti-LRRC26 polyclonal antibody is used to tag leucine-rich repeat (LRR)-containing protein 26 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine-rich repeat (LRR)-containing protein 26 as a modulator of BK channel hyperpolarization activation and Slo3 channel alkalization activation.

Sequenza

Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable