SAB5702875

Anti-Syntaxin 4 Antibody, clone 8F3P7, Rabbit Monoclonal

• Synonyme(s) : STX4A, p35-2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 8F3P7, monoclonal
• Forme: liquid
• Poids mol.: 34 kDa
• Espèces réactives: rat, human, rat
• Concentration: 1.3 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: QTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
• Numéro d'accès UniProt: Q12846
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... STX4(6810)

Description

Description générale

Plasma membrane t-SNARE that mediates docking of transport vesicles (By similarity. Necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane (By similarity. In neurons, recruited at neurite tips to membrane domains rich in the phospholipid 1-oleoyl-2-palmitoyl-PC (OPPC which promotes neurite tip surface expression of the dopamine transporter SLC6A3/DAT by facilitating fusion of SLC6A3-containing transport vesicles with the plasma membrane (By similarity. Together with STXB3 and VAMP2, may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes and in docking of synaptic vesicles at presynaptic active zones (By similarity.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (Q12846).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1