SAB5702444

Anti-Rad50 Antibody, clone 5M2K10, Rabbit Monoclonal

• Synonyme(s) : NBSLD, RAD502, hRad50
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 5M2K10, monoclonal
• Forme: liquid
• Poids mol.: 154 kDa
• Espèces réactives: rat, human, rat
• Concentration: 0.85 mg/mL
• Technique(s): immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: RCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRSQQRNFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIV
• Numéro d'accès UniProt: Q92878
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... RAD50(10111)

Description

Description générale

The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Rad50, a protein involved in DNA double-strand break repair. This protein forms a complex with MRE11 and NBS1. The protein complex binds to DNA and displays numerous enzymatic activities that are required for nonhomologous joining of DNA ends. This protein, cooperating with its partners, is important for DNA double-strand break repair, cell cycle checkpoint activation, telomere maintenance, and meiotic recombination. Knockout studies of the mouse homolog suggest this gene is essential for cell growth and viability. Mutations in this gene are the cause of Nijmegen breakage syndrome-like disorder.[provided by RefSeq, Apr 2010]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Rad50 (Q92878).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB,IP

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1