SAB5702289

Anti-COX6B1 Antibody, clone 7T0J5, Rabbit Monoclonal

• Synonyme(s) : COX6B1, COX6B, COXG, COXVIb1, cytochrome c oxidase subunit 6B1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 7T0J5, monoclonal
• Forme: liquid
• Poids mol.: 10 kDa
• Espèces réactives: human
• Concentration: 0.80 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
• Numéro d'accès UniProt: P14854
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... COX6B1(1340)

Description

Description générale

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-86 of human COX6B1 (P14854).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1