SAB2101093

Anti-HSP90AA1 (ab2) antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-FLJ31884, Anti-HSP86, Anti-HSP90A, Anti-HSP90N, Anti-Heat shock protein 90kDa α (cytosolic), class A member 1
• Numéro MDL: MFCD01865538
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 98 kDa
• Espèces réactives: mouse, rabbit, human, guinea pig, rat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès UniProt: P07900
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... HSP90AA1(3320)

Description

Immunogène

Synthetic peptide directed towards the N terminal region of human HSP90AA1

Actions biochimiques/physiologiques

HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. There are 2 major cytosolic HSP90 proteins, HSP90AA1, an inducible form, and HSP90AB1 (MIM 140572), a constitutive form. Other HSP90 proteins are found in endoplasmic reticulum (HSP90B1; MIM 191175) and mitochondria (TRAP1; MIM 606219).

Séquence

Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable