Accéder au contenu
Merck
Toutes les photos(1)

Documents

MSST0038

Sigma-Aldrich

SILu™Lite IGFBP7 Insulin-like growth factor-binding protein 7 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonyme(s) :

IBP-7, IGF-binding protein 7, IGF-bindingprotein7, IGFBP-7, IGFBP-rP1, MAC25 protein, PGI2-stimulating factor, Prostacyclin-stimulating factor, Tumor-derived adhesion factor (TAF)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

Source biologique

human

Niveau de qualité

200

Produit recombinant

expressed in HEK 293 cells

Pureté

≥98% (SDS-PAGE)

Forme

lyophilized powder

Puissance

≥98 Heavy amino acids incorporation efficiency by MS

Technique(s)

mass spectrometry (MS): suitable

Adéquation

suitable for mass spectrometry (internal calibrator)

Numéro d'accès UniProt

Q16270

Température de stockage

−20°C

Informations sur le gène

human ... IGFBP7(3490)

Catégories apparentées

Description générale

IGFBP7 (insulin-like growth factor-binding protein 7) belongs to the IGFBP superfamily and is widely expressed in tissues. It contains 11 cysteines, a heparin binding site, a kazal-type trypsin inhibitor domain and a carboxyl-terminal immunoglobulin-like type C repeat. IGFBP7 binds weakly to IGFs (insulin like growth factors) and strongly to insulin. It mainly participates in IGF-independent pathways. The IGFBP7 gene is mapped to human chromosome 4q12.
SILu™ Lite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Immunogène

HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Actions biochimiques/physiologiques

IGFBP7 (insulin-like growth factor-binding protein 7) acts as a tumor suppressor as well as an oncogene by controlling cell proliferation, cell attachment, apoptosis and angiogenesis. It is also involved in TGFβ (transforming growth factor beta) signal pathway. IGFBP7 interferes with the insulin pathway and is associated with the development of diabetes as well as cardiovascular diseases.
SILu™Lite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Methylation status of insulin-like growth factor-binding protein 7 concurs with the malignance of oral tongue cancer.
Chen L H, et al.
Journal of Experimental & Clinical Cancer Research, 34(1), 20-20 (2015)
Overexpressed Skp2 within 5p amplification detected by array?based comparative genomic hybridization is associated with poor prognosis of glioblastomas
Saigusa K, et al.
Cancer Science, 96(10), 676-683 (2005)
Yi Liu et al.
Scientific reports, 5, 10227-10227 (2015-05-20)
Metabolic syndrome (MetS), one of the major public health concerns, is regarded as the "common soil" of incidence of common chronic diseases and may increase the risk of type 2 diabetes. The predominant underlying mechanism of MetS is insulin resistance

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique