HPA010645

Anti-SAMSN1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Hematopoietic adaptor containing SH3 and SAM domains 1, Anti-SAM domain, SH3 domain and nuclear localization signals protein 1, Anti-SAM domain-containing protein SAMSN-1, Anti-SH3-SAM adaptor protein
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA010645
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Séquence immunogène: TEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFC
• Numéro d'accès UniProt: Q9NSI8
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SAMSN1(64092)

Description

Description générale

SAMSN1 (SAM domain, SH3 domain and nuclear localization signals 1) gene encodes a member of the SLY family of cytoplasmic adaptor proteins. It is abundantly expressed in the hematopoietic compartment. The protein is also expressed in heart, brain, placenta, and lung to a lesser extent. The members of this family are characterized by the presence of protein-protein interaction domains and are homologous. They contain a sterile α motif (SAM) domain that is capable of self-association and can also associate with each other. The chimeric fusion of this domain with the βPDGF receptor, AML1, c-Abl, and JAK2 results in the oncogenic transformation of the SAM domain. The SH3 domains mediate protein-protein interactions in several signal transduction pathways. The gene is localized to human chromosome 21 (21q11.2).

Immunogène

SAM domain-containing protein SAMSN-1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

SAMSN1 (SAM domain, SH3 domain and nuclear localization signals 1) protein may be involved in the formation of blood vessel during normal brain development. It may function as an adaptor or scaffolding protein. It has been found to be overexpressed in glioma and is associated with a poor survival in glioblastoma multiforme. In mice, this protein may function in moderating adaptive immune responses. SAMSN1 may be involved in B cell activation and differentiation. It has been suggested to be a tumor suppressor in lung cancer. It may serve as a biomarker of the phenotype of human hepatocellular carcinoma.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71504

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)