Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV42455

Sigma-Aldrich

Anti-ABHD5 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Abhydrolase domain containing 5, Anti-CDS, Anti-CGI58, Anti-IECN2, Anti-MGC8731, Anti-NCIE2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

39 kDa

Espèces réactives

rabbit, dog, bovine, mouse, rat, sheep, human, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... ABHD5(51099)

Description générale

ABHD5/CGI58 product 1-acylglycerol-3-phosphate O-acyltransferase is a signaling agent that co-activates adipose triglyceride lipase and acylation of lysophosphatidic acid (LPA). ABHD5 (1-acylglycerol-3-phosphate O-acyl-transferase) is a member of the esterase/lipase/thioesterase subfamily that has been associated with a triglyceride storage disease involving impaired long-chain fatty acid oxidation, known as Chanarin-Dorfman syndrome, a rare neutral lipid disorder characterised by icthyosis, hepatic steatosis.

Spécificité

Anti-ABHD5/CGI58 antibody reacts with a sequence of the enzyme human1-acylglycerol-3-phosphate O-acyltransferase.

Immunogène

Synthetic peptide directed towards the N terminal region of human ABHD5

Application

Anti-ABHD5/CGI58 is a rabbit IgG polyclonal antibody used to tag comparative gene identification 58 (CGI58) proteins for detection and quantitation by Western blotting and in tissues by immunohistochemical (IHC) techniques.

Actions biochimiques/physiologiques

ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.

Séquence

Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Caleb C Lord et al.
Diabetes, 61(2), 355-363 (2012-01-10)
Mutations of comparative gene identification 58 (CGI-58) in humans cause Chanarin-Dorfman syndrome, a rare autosomal recessive disease in which excess triacylglycerol (TAG) accumulates in multiple tissues. CGI-58 recently has been ascribed two distinct biochemical activities, including coactivation of adipose triglyceride
Ananda K Ghosh et al.
The Journal of biological chemistry, 283(36), 24525-24533 (2008-07-09)
cgi-58 (comparative gene identification-58) is a member of alpha/beta-hydrolase family of proteins. Mutations in CGI-58 are shown to be responsible for a rare genetic disorder known as Chanarin-Dorfman syndrome, characterized by an excessive accumulation of triacylglycerol in several tissues and
Gabriela Montero-Moran et al.
Journal of lipid research, 51(4), 709-719 (2009-10-06)
Mutations in human CGI-58/ABHD5 cause Chanarin-Dorfman syndrome (CDS), characterized by excessive storage of triacylglycerol in tissues. CGI-58 is an alpha/beta-hydrolase fold enzyme expressed in all vertebrates. The carboxyl terminus includes a highly conserved consensus sequence (HXXXXD) for acyltransferase activity. Mouse

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique