Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV40182

Sigma-Aldrich

Anti-HOMER1 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-HOMER1A, Anti-HOMER1B, Anti-HOMER1C, Anti-Homer homolog 1 (Drosophila), Anti-SYN47, Anti-Ves-1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

39 kDa

Espèces réactives

pig, rabbit, human, rat, dog, horse, bovine, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HOMER1(9456)

Description générale

Homer proteins are cytoplasmic adaptor proteins that contain the Ena/VASP homology 1 domain that binds to the PPXXF sequence motifs found in Ca2+ handling proteins such as IP3 receptors, transient receptor potential canonical (TRPC) channels and ryanodine receptor (RyR) Ca2+ release channels. HOMER1, a calcium signaling complex modulator, is involved in the opening and closing of TRPC channels such as the endoplasmic reticulum store-operated Ca2+ -influx channels (SOCs). Homer1 plays a critical role in determining the apoptotic susceptibility to TRAIL, an apoptotic cell death-inducing ligand that belongs to a TNF superfamily.

Spécificité

Anti-HOMER1 (AB2) polclonal antibody reacts with canine, human, mouse, rat, and bovine homer 1 adaptor proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human HOMER1

Application

Anti-HOMER1 (AB2) polclonal antibody is used to tag the homer 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of homer 1 as a modulator of calcium transport and signaling involved in apoptosis, body movement and various cellular processes.

Actions biochimiques/physiologiques

HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Séquence

Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique