Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV32048

Sigma-Aldrich

Anti-CNOT2 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-CCR4-NOT transcription complex, subunit 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

40 kDa

Espèces réactives

dog, rabbit, mouse, bovine, human, rat, horse, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_055330

Numéro d'accès UniProt

Q9NZN8-2

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CNOT2(4848)

Description générale

CNOT2 forms a part of the transcriptional regulator, the Ccr4-Not complex, and can repress promoter functions. Studies have reported that depletion of CNOT2 inhibits CCR4-NOT deadenylase and causes apoptosis in cells. Furthermore, the SMRT/NCoR-HDAC3 complex is known to be a cofactor of CNOT2-mediated transcriptional repression.
Rabbit Anti-CNOT2 antibody recognizes bovine, human, mouse, rat, canine, and chicken CNOT2.

Immunogène

Synthetic peptide directed towards the middle region of human CNOT2

Application

Rabbit Anti-CNOT2 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Actions biochimiques/physiologiques

CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.

Séquence

Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Carin G M Zwartjes et al.
The Journal of biological chemistry, 279(12), 10848-10854 (2004-01-07)
The evolutionary conserved Ccr4-Not complex controls mRNA metabolism at multiple levels in eukaryotic cells. Genetic analysis of not mutants in yeast identifies a negative role in transcription, which is dependent on core promoter structure. To obtain direct support for this
Kentaro Ito et al.
Genes to cells : devoted to molecular & cellular mechanisms, 16(4), 368-379 (2011-02-09)
Eukaryotic mRNA decay is initiated by shortening of the poly (A) tail; however, neither the molecular mechanisms underlying deadenylation nor its regulation is well understood. The human CCR4-NOT complex is a major cytoplasmic deadenylase consisting of a combination of at
Sandrine Jayne et al.
The Biochemical journal, 398(3), 461-467 (2006-05-23)
In eukaryotic cells, the Ccr4-Not complex can regulate mRNA metabolism at various levels. Previously, we showed that promoter targeting of the CNOT2 subunit resulted in strong repression of RNA polymerase II transcription, which was sensitive to the HDAC (histone deacetylase)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique