Skip to Content
Merck
All Photos(2)

Documents

HPA014641

Sigma-Aldrich

Anti-TNFAIP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-B12, Anti-B61, Anti-BTBD34, Anti-EDP1, Anti-MGC2317

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TNFAIP1(7126)

General description

TNFAIP1 (tumor necrosis factor, α-induced protein 1) was first discovered as an interleukin-6 (IL-6) and tumor necrosis factor (TNF) α-inducible protein. It is a highly conserved protein and is conserved across humans, rat and C. elegans. It is highly expressed in brain and heart, and its expression is determined by the developmental stage. Its N-terminal contains the conserved BTB/POZ (BR-C, ttk and bab/ Pox virus and Zinc finger) domain. This gene is located on human chromosome 17q22-q23, and codes for a protein with predicted 316-amino acids

Immunogen

BTB/POZ domain-containing protein TNFAIP1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

TNFAIP1 (tumor necrosis factor, α-induced protein 1) is expressed according to the developmental stage, and is highly expressed in brain and heart. Therefore, it might play an essential role in the development of brain and heart. In endothelial cells, its expression is induced by TNFα, by the transcription factor Sp1 (specificity protein 1). TNFAIP1 is thus involved in inflammation-related angiogenesis. It acts as a ligand for Eck receptor protein tyrosine kinase (RPTK), when stimulated by TNFα under inflammatory conditions, and hence, promotes angiogenesis and resulting chronic inflammation. It is pro-apoptotic in nature, and when induced by RhoB, it induces apoptosis via the SAPK/JNK (Stress-activated protein kinase/c-Jun NH2-terminal kinase)-mediated signal pathway. It also suppresses the activation of nuclear factor κ B (NF-κB) and activating protein-1 reporters, by interacting with and degrading potassium channel tetramerisation domain containing 10 (KCTD10).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72581

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

F W Wolf et al.
The Journal of biological chemistry, 267(2), 1317-1326 (1992-01-15)
The response of endothelial cells to the cytokine tumor necrosis factor-alpha (TNF) is complex, involving the induction and suppression of multiple genes and gene products. Differential screening of a TNF-stimulated, cycloheximide-treated human umbilical vein endothelial cell library has resulted in
Dong-Myung Kim et al.
International journal of cancer, 125(11), 2520-2527 (2009-07-29)
RhoB, a tumor suppressor, has emerged as an interesting cancer target, and extensive studies aimed at understanding its role in apoptosis have been performed. In our study, we investigated the involvement of RhoB-interacting molecules in apoptosis. To identify RhoB-interacting proteins
Xiang Hu et al.
Molecular biology reports, 39(11), 9911-9919 (2012-07-20)
The broad-complex, tramtrack, and bric-a-brac/poxvirus and zinc finger domain-containing protein tumor necrosis factor, alpha-induced protein 1 (TNFAIP1) was first identified as a gene whose expression can be induced by the tumor necrosis factor alpha. Some studies showed that TNFAIP1 may
A Pandey et al.
Science (New York, N.Y.), 268(5210), 567-569 (1995-04-28)
B61, a cytokine-inducible endothelial gene product, is the ligand for the Eck receptor protein tyrosine kinase (RPTK). Expression of a B61-immunoglobulin chimera showed that B61 could act as an angiogenic factor in vivo and a chemoattractant for endothelial cells in
Mingjun Liu et al.
Molecular biology reports, 37(4), 1699-1705 (2009-07-14)
Tumor necrosis factor, alpha-induced protein 1 (TNFAIP1) is an immediate-early response gene of endothelium induced by TNF alpha. However, little is really known concerning the TNFAIP1 expression regulation. To better understand how TNFAIP1 expression is regulated, we functionally characterized the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service