WH0000246M4
Monoclonal Anti-ALOX15 antibody produced in mouse
clone 3D8, purified immunoglobulin, buffered aqueous solution
Synonym(e):
Anti-arachidonate 15-lipoxygenase
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(4)
About This Item
Biologische Quelle
mouse
Konjugat
unconjugated
Antikörperform
purified immunoglobulin
Antikörper-Produkttyp
primary antibodies
Klon
3D8, monoclonal
Form
buffered aqueous solution
Speziesreaktivität
human
Methode(n)
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotyp
IgG2aκ
GenBank-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
dry ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... ALOX15(246)
Allgemeine Beschreibung
The gene arachidonate 15-lipoxygenase (ALOX15) is mapped to human chromosome 17p13. It is mainly present in the epithelial cells in the upper airways, reticulocytes, eosinophils and macrophages. ALOX15 belongs to the dioxygenases family. It is an IL-4 (interleukin 4)/IL-13 target gene.
Immunogen
ALOX15 (AAH29032, 1 a.a. ~ 662 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Sequence
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Biochem./physiol. Wirkung
ALOX15 (arachidonate 15-lipoxygenase) is involved in homeostatic as well as pathological responses. ALOX15 is responsible for the oxidation of unsaturated fatty acids (at the 15 position) to active hydroperoxy and epoxy metabolites. It is also responsible for the conversion of linoleic acid to anti-tumor 13-S-hydroxyoctadecadienoic acid. ALOX15 is required for IL-4 (interleukin-4)/IL-13-mediated macrophage polarization. In mice, it is a negative regulator of bone mineral density. It is also involved in fatty acid metabolism. It controls MAPK (mitogen activated protein kinase) signaling in human airway epithelial cells using phosphatidylethanolamine-binding protein.
Leistungsmerkmale und Vorteile
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physikalische Form
Solution in phosphate buffered saline, pH 7.4
Rechtliche Hinweise
GenBank is a registered trademark of United States Department of Health and Human Services
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Persönliche Schutzausrüstung
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Polymorphisms in inflammation associated genes ALOX15 and IL-6 are associated with bone properties in young women and fracture in elderly.
Herlin M, et al.
Bone, 79, 105-105 (2015)
12/15 Lipoxygenase regulation of colorectal tumorigenesis is determined by the relative tumor levels of its metabolite 12-HETE and 13-HODE in animal models.
Chang J, et al.
Oncotarget, 6, 2879-2879 (2015)
15-Lipoxygenase 1 interacts with phosphatidylethanolamine-binding protein to regulate MAPK signaling in human airway epithelial cells.
Zhao J, et al.
Proceedings of the National Academy of Sciences of the USA, 108, 14246-14246 (2011)
Interaction of human 15-lipoxygenase-1 with phosphatidylinositol bisphosphates results in increased enzyme activity.
Andersson E, et al.
Biochimica et Biophysica Acta, 1761, 1498-1498 (2006)
Dmitry Namgaladze et al.
The Journal of biological chemistry, 290(40), 24484-24494 (2015-08-16)
Macrophages respond to the Th2 cytokine IL-4 with elevated expression of arachidonate 15-lipoxygenase (ALOX15). Although IL-4 signaling elicits anti-inflammatory responses, 15-lipoxygenase may either support or inhibit inflammatory processes in a context-dependent manner. AMP-activated protein kinase (AMPK) is a metabolic sensor/regulator
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.