Direkt zum Inhalt
Merck

HPA010926

Sigma-Aldrich

Anti-ALCAM antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-Activated leukocyte-cell adhesion molecule antibody produced in rabbit, Anti-CD166 antigen precursor antibody produced in rabbit

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

MDL-Nummer:
UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunohistochemistry: 1:50-1:200

Immunogene Sequenz

NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... ALCAM(214)

Allgemeine Beschreibung

Activated leukocyte cell adhesion molecule (ALCAM) belongs to the superfamily of immunoglobulin cell adhesion molecules (Ig-CAMs). Its extracellular domain consist of five immunoglobulin (Ig)-like domains, which aid in cell-cell adhesion, either through heterophilic (ALCAM-CD6) or homophilic (ALCAM-ALCAM) interactions. It is a type I transmembrane protein. It has a short cytoplasmic tail and a transmembrane region, and has a molecular weight of 110kDa. It is expressed in a wide range of tissues, especially in the epithelia and the corresponding cancers. ALCAM gene maps to human chromosome 3q13.1-q13.2.

Immunogen

CD166 antigen precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-ALCAM antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

Activated leukocyte cell adhesion molecule (ALCAM) mediates cell-cell adhesion, either through heterophilic (ALCAM-CD6) or homophilic (ALCAM-ALCAM) interactions. Hemophilic interactions aid in cell migration and invasiveness of tumor cells. ALCAM present on dendritic cells, induces T-cell activation by interacting with cluster of differentiation 6 (CD6) present on T-cells. This heterophilic interaction is necessary for the stabilization of immunological synapses. It mediates the extravasation of leukocytes and their transport to the central nervous system, as well as axonal fasciculation. Colorectal cancer patients, who show increased levels of ALCAM shedding, have poor prognosis and survival rates. The soluble form of ALCAM is related to the aggressive type II phenotype of epithelial ovarian cancer, and can be used as a marker for the same.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72229

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

ALCAM: Basis Sequence: Mouse.
Amanda G Hansen et al.
The AFCS-nature molecule pages, 2011 (2011-01-01)
Pedro Nicolau-Neto et al.
Cancers, 12(2) (2020-02-23)
Laryngeal squamous cell carcinoma (LSCC) is one of the most incident tumors in the world, especially in developing countries, such as Brazil. Different from other tumors, LSCC prognosis did not improve during the past four decades. Therefore, the objective of
Joost Te Riet et al.
Journal of cell science, 127(Pt 7), 1595-1606 (2014-02-06)
At the immunological synapse, the activated leukocyte cell adhesion molecule (ALCAM) on a dendritic cell (DC) and CD6 molecules on a T cell contribute to sustained DC-T-cell contacts. However, little is known about how ALCAM-CD6 bonds resist and adapt to
C Kahlert et al.
British journal of cancer, 101(3), 457-464 (2009-07-16)
ALCAM (activated leucocyte cell adhesion molecule, synonym CD166) is a cell adhesion molecule, which belongs to the Ig superfamily. Disruption of the ALCAM-mediated adhesiveness by proteolytic sheddases such as ADAM17 has been suggested to have a relevant impact on tumour
Amanda G Hansen et al.
Cancer research, 73(10), 2955-2964 (2013-03-30)
Molecular biomarkers of cancer are needed to assist histologic staging in the selection of treatment, outcome risk stratification, and patient prognosis. This is particularly important for patients with early-stage disease. We show that shedding of the extracellular domain of activated

Artikel

Mesenchymal stem cell markers and antibodies suitable for investigating targets in fibroblasts, chondrocytes, adipocytes, osteoblasts, and muscle cells.

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.