AV35650

Anti-SLC18A1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Solute carrier family 18 (vesicular monoamine), member 1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 56 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001129163
• UniProt-Hinterlegungsnummer: P54219
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC18A1(6570)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC18A1

Biochem./physiol. Wirkung

Solute carrier family 18 (vesicular monoamine), member 1 (SLC18A1) is a vesicular monamine transporter that is involved in the transport of monoamine neurotransmitters. It accumulates cytosolic monoamines into vesicles based on the proton gradient. Variations in SLC18A1 transporter have been observed in neuropsychiatric disorders.

Sequenz

Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable