WH0007852M2

Monoclonal Anti-CXCR4 antibody produced in mouse

clone 1F8, ascites fluid

• Synonyme(s) : Anti-CD184, Anti-D2S201E, Anti-FB22, Anti-HM89, Anti-HSY3RR, Anti-LAP3, Anti-LCR1, Anti-LESTR, Anti-NPY3R, Anti-NPYR, Anti-NPYRL, Anti-NPYY3R, Anti-WHIM, Anti-chemokine (C-X-C motif) receptor 4
• Numéro MDL: MFCD01092337
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 1F8, monoclonal
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC020968
• Numéro d'accès UniProt: P61073
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CXCR4(7852)

Description

Description générale

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogène

CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Forme physique

Solution

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)