WH0000174M1
Monoclonal Anti-AFP antibody produced in mouse
clone 1G7, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
Anti-FETA, Anti-HPAFP, Anti-alpha-fetoprotein
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
mouse
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
1G7, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
Isotype
IgGκ
Numéro d'accès GenBank
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... AFP(174)
Catégories apparentées
Description générale
This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. (provided by RefSeq)
Immunogène
AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Application
Monoclonal Anti-AFP antibody produced in mouse has been used in immunocytochemistry.
Actions biochimiques/physiologiques
Alpha-fetoprotein encoded by the gene AFP is involved in the regulation of fatty acids in both fetal and proliferating adult liver cells. Its expression is found to be increased in acute liver injuries, indicating active liver regeneration. It has been associated with fatty liver disease (FLD), a disease that may lead to cirrhosis and hepatocellular carcinoma. It serves as a tumor marker for HCC (hepatocellular carcinoma).
Caractéristiques et avantages
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Informations légales
GenBank is a registered trademark of United States Department of Health and Human Services
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
En option
Réf. du produit
Description
Tarif
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Carla Sanjurjo-Soriano et al.
Stem cell research, 33, 247-250 (2018-11-24)
We generated an induced pluripotent stem cell (iPSC) line using dermal fibroblasts from a patient with Usher syndrome type 2 (USH2). This individual was homozygous for the most prevalent variant reported in the USH2A gene, c.2299delG localized in exon 13.
Anika Neureiter et al.
Stem cell research, 33, 20-24 (2018-10-09)
Angelman syndrome (AS) is a neurodevelopmental disorder with leading symptoms of happy demeanor, intellectual disability, ataxia and seizures. AS can be caused by genetic and epigenetic aberrations, resulting in the absence of functional UBE3A protein in the brain. UBE3A is
Björn Lichtner et al.
Stem cell research, 15(3), 697-699 (2016-03-19)
Primary human chorionic villi (CV) cells were used to generate the iPSC line by retroviral transduction of the four Yamanaka-factors OCT4, SOX2, KLF4 and c-MYC. Pluripotency was confirmed both in vivo and in vitro. The transcriptomes of the CV-derived iPSC
Julia Tigges et al.
ALTEX, 38(4), 595-614 (2021-05-09)
Human induced pluripotent stem cells (hiPSC) are a promising tool for replacing animal-based experiments. To warrant data reproducibility, quality-controlled research material is recommended. While the need for global harmonization of quality standards for stem cell banking centers, commercial providers, pre-clinical
Gergő Vőfély et al.
Molecular and cellular neurosciences, 88, 222-230 (2018-02-10)
Pluripotent stem cell derived human neuronal progenitor cells (hPSC-NPCs) and their mature neuronal cell culture derivatives may efficiently be used for central nervous system (CNS) drug screening, including the investigation of ligand-induced calcium signalization. We have established hippocampal NPC cultures
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique