Accéder au contenu
Merck
Toutes les photos(4)

Key Documents

SAB2108752

Sigma-Aldrich

Anti-WT1

affinity isolated antibody

Synonyme(s) :

Anti- AWT1, Anti- WAGR, Anti- WIT-2, Anti- WT33, Anti-GUD

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

56 kDa

Espèces réactives

human, rabbit, dog, rat, mouse

Concentration

0.5-1 mg/mL

Technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

Numéro d'accès

NM_024424

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... WT1(7490)

Description générale

Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.

Immunogène

Synthetic peptide directed towards the middle region of human WT1

Actions biochimiques/physiologiques

WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.

Séquence

Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
Stoll R, et al.
Journal of Molecular Biology, 372(5), 1227-1245 (2007)
Donor splice-site mutations in WT1 are responsible for Frasier syndrome
Barbaux S, et al.
Nature Genetics, 17(4), 467-467 (1997)
Wilms? tumor 1 (WT1) protein expression in human developing tissues
Parenti R, et al.
Acta Histochemica, 117(4-5), 386-396 (2015)
The tumor suppressor WTX shuttles to the nucleus and modulates WT1 activity
Rivera et al.
Proceedings of the National Academy of Sciences of the USA, 106(20), 8338-8343 (2009)
New insights into DNA-binding behaviour of Wilms Tumor Protein (WT1)?A dual study
Nurmemmedov E, et al.
Biophysical Chemistry, 145(2-3), 116-125 (2009)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique