SAB1402832

Monoclonal Anti-L1CAM antibody produced in mouse

clone 3B10, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : CAML1, CD171, HSAS, HSAS1, MASA, MIC5, N-CAML1, S10, SPG1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3B10, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~38.21 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès NCBI: NM_000425
• Numéro d'accès UniProt: P32004
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... L1CAM(3897)

Description

Description générale

The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant. (provided by RefSeq)

Immunogène

L1CAM (NP_000416, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMA

Actions biochimiques/physiologiques

The gene L1CAM (L1 cell adhesion molecule) encodes a glycoprotein that functions in axon growth during development and axon bundling. It interacts with Schwann cells and axons, and mediates neuronal cell migration, and neuronal cell survival. Overexpression of this protein is associated with tumor progression. It has been found to mediate therapeutic resistance in ovarian and pancreatic cancer cells.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable