HPA003157

Anti-BGN antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Biglycan precursor antibody produced in rabbit, Anti-Bone/cartilage proteoglycan I antibody produced in rabbit, Anti-PG-S1 antibody produced in rabbit
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA003157
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Séquence immunogène: RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
• Numéro d'accès UniProt: P21810
• Application(s): research pathology
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... BGN(633)

Description

Description générale

BGN (biglycan), also called proteoglycan I (PGI), which belongs to the family of proteoglycans called small leucine-rich proteoglycan (SLRP). This protein is composed of characteristic leucine-rich repeat motifs located centrally. These motifs are linked by disulfide bond stabilized loops. It is predominantly expressed in tissues of mesenchymal type, and is found in the cell surface or in the pericellular matrix.

Immunogène

Biglycan precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-BGN antibody produced in rabbit is suitable for use in measuring the concentration of biglycan by sandwich ELISA method.
Anti-BGN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

BGN (biglycan) gene encodes a leucine-rich, pericellular matrix proteoglycan that functions in the assembly of collagen fibrils and muscle regeneration. It belongs to the decorin family of proteins and contains two chains of chondroitin sulfate. It interacts with transforming growth factor β and may function in regulating its activities. The distribution of this protein indicates that it may be involved in the physiology of the neuromuscular junction, and morphogenesis and differentiation of tissues. The protein functions as an endogenous ligand for Toll-like receptors, TLR4 and TLR2, that are involved in innate immunity. It enhances inflammation via TLR4 and TLR2 signaling, leading to the synthesis of TNF-α (Tumor necrosis factor-α) and MIP-2 (macrophage inflammatory protein-2).

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74436

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)