AV41446
Anti-MUC1 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Synonyme(s) :
Anti-CD227, Anti-EMA, Anti-Mucin, Anti-Mucin 1, cell surface associated, Anti-PEM, Anti-PUM
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
IgG fraction of antiserum
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
22 kDa
Espèces réactives
dog, human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
immunohistochemistry: suitable
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... MUC1(4582)
Description générale
MUC1 (Mucin 1) is O-glycosylated, carbohydrate rich, transmembrane glycoprotein. It has approximately 13 members in the family. It is localized on the apical surface of mucosal epithelia in the lung, eye, breast and stomach. It is overexpressed in several epithelial cancers, including pancreatic ductal adenocarcinoma. It is a heterodimer consisting of N-terminal (MUC1-N) and C-terminal (MUC1-C) subunits. N-terminal (MUC1-N) end contains tandem repeats (VNTR) which forms the mucin component.
Immunogène
Synthetic peptide directed towards the C terminal region of human MUC1
Application
Anti-MUC1 (AB2) antibody produced in rabbit is suitable for immunohistochemistry and western blot.
Actions biochimiques/physiologiques
MUC1 (Mucin 1) plays a major role in the formation of epithelium lining of the gastrointestinal tract. It lubricates the gastrointestinal tract to protect the epithelia from oesophagus to the colon. It also lubricates the epithelia of some organs such as pancreas and gall bladder. It is directly involved in several signaling pathways as s a modulator that affects oncogenesis, motility and metastasis.
Séquence
Synthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Irina I Tyuryaeva et al.
Scientific reports, 7, 40217-40217 (2017-01-17)
Antitumor GO peptides have been designed as dimerization inhibitors of prominent oncoprotein mucin 1. In this study we demonstrate that activity of GO peptides is independent of the level of cellular expression of mucin 1. Furthermore, these peptides prove to
A P Corfield et al.
Frontiers in bioscience : a journal and virtual library, 6, D1321-D1357 (2001-10-02)
Mucins form part of the dynamic, interactive mucosal defensive system active at the mucosal surface of the gastrointestinal tract. They are carbohydrate rich glycoproteins with unique molecular structure and chemical properties. The family of mucin (MUC) genes has 13 members
C J Reid et al.
Gut, 42(2), 220-226 (1998-04-16)
Mucin glycoproteins play a key role in the normal function of the epithelium lining the gastrointestinal tract. The expression of mucin genes, MUC 3, 4, 5AC, 5B, 6, 7, and 8 in human fetal tissues was examined to establish the
M Sahraei et al.
Oncogene, 31(47), 4935-4945 (2012-01-24)
Pancreatic ductal adenocarcinoma (PDA) has one of the worst prognoses of all cancers. Mucin 1 (MUC1), a transmembrane mucin glycoprotein, is a key modulator of several signaling pathways that affect oncogenesis, motility and metastasis. Its expression is known to be
Lili Zhang et al.
The Journal of pathology, 234(1), 60-73 (2014-05-20)
Cigarette smoke increases the risk of lung cancer by 20-fold and accounts for 87% of lung cancer deaths. In the normal airway, heavily O-glycosylated mucin-1 (MUC1) and adherens junctions (AJs) establish a structural barrier that protects the airway from infectious
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique