Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Principaux documents

WH0051435M1

Sigma-Aldrich

Monoclonal Anti-SCARA3 antibody produced in mouse

clone 3A2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-APC7, Anti-CSR, Anti-CSR1, Anti-MSLR1, Anti-MSRL1, Anti-scavenger receptor class A, member 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
718,00 $

718,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Toutes les photos(6)

Sélectionner une taille de conditionnement

Changer de vue
100 μG
718,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

718,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3A2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

rat, human, mouse

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_016240

Numéro d'accès UniProt

Q6AZY7

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SCARA3(51435)

Catégories apparentées

Description générale

This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative stress. Alternatively spliced transcript variants encoding distinct isoforms have been described. (provided by RefSeq)

Immunogène

SCARA3 (NP_057324, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE

Actions biochimiques/physiologiques

Scavenger receptor class A member 3 (SCARA3) protects cells against ultraviolet (UV) irradiation and oxidative stress. Reduced expression of SCARA3 increases oxidative stress in keratoconus (KC) cells in vitro. Quantitative polymerase chain reaction (PCR) analysis proves that SCARA3 transcript is highly expressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared to breast carcinoma effusions. SCARA3 represses tumor growth and metastasis of prostate cancer. Therefore, it can be used as a potential therapeutic target for treating aggressive types of prostate cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
07124-3A2

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Charles O Brown et al.
Leukemia research, 37(8), 963-969 (2013-03-30)
This study evaluates the role of scavenger receptor class A member 3 (SCARA3) in multiple myeloma (MM). SCARA3 expression was induced upon treatment with oxidative stressors (ionizing radiation and chemotherapeutic drugs). An epigenetic inactivation of SCARA3 was noted in MM.1S
Guoying Yu et al.
The American journal of pathology, 168(2), 597-607 (2006-01-27)
Prostate cancer is frequent among men over 45 years of age, but it generally only becomes lethal with metastasis. In this study, we identified a gene called cellular stress response 1 (CSR1) that was frequently down-regulated and methylated in prostate
Downregulation of SCARA3, CPSF3 and FOXM1 in Keratoconus Cells in vitro
CM Kenney
Investigative Ophthalmology & Visual Science, 53, 1112-1112 (2012)
H J Han et al.
Human molecular genetics, 7(6), 1039-1046 (1998-06-13)
Oxidative stress is a pathogenic condition that causes cellular damage and, in a normally functioning cell, several transcription factors respond to this threat by modulating expression of genes whose products ameliorate the altered redox status in some way. We have
Annika J Bock et al.
Human pathology, 43(5), 669-674 (2011-08-23)
Scavenger receptor class A, member 3 (SCARA3) was previously found to be overexpressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared with breast carcinoma effusions by global gene expression analysis. The present study aimed to validate this finding applying quantitative PCR and

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique