SAB5702576

Anti-Pannexin 1 Antibody, clone 7E8T3, Rabbit Monoclonal

• Synonyme(s) : MRS1, PX1, UNQ2529
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 7E8T3, monoclonal
• Forme: liquid
• Poids mol.: 50 kDa
• Espèces réactives: rat, rat, human
• Concentration: 0.11 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC
• Numéro d'accès UniProt: Q96RD7
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PANX1(24145)

Description

Description générale

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties. [provided by RefSeq, Jul 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 327-426 of human Pannexin 1 (Q96RD7).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1