Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB2102648

Sigma-Aldrich

Anti-UHRF2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DKFZp434B0920, Anti-DKFZp686G0837, Anti-MGC33463, Anti-NIRF, Anti-Ubiquitin-like, containing PHD and RING finger domains, 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

90 kDa

Espèces réactives

guinea pig, horse, rabbit, human, mouse, dog, bovine, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... UHRF2(115426)

Description générale

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) belongs to the ubiquitin plant homeodomain RING finger (UHRF) family. The gene is located on human chromosome 9p24.1. The protein consists of ubiquitin-like (UBL) domain, tandem tudor domain (TTD), plant homeodomain (PHD) finger domain, SET and RING associated (SRA) domain and RING finger domain.

Immunogène

Synthetic peptide directed towards the middle region of human UHRF2

Actions biochimiques/physiologiques

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
UHRF2 is overexpressed in colorectal cancer cells and functions as an oncogene in breast cancer cells. UHRF2 domains are required for the regulation of cell cycle network, epigenetic system and UPS (ubiquitin proteasome system). The protein plays an important role in the nuclear degradation of polyglutamine aggregates. UHRF2 is involved in the DNA damage repair of aortic vascular smooth muscle cells.

Séquence

Synthetic peptide located within the following region: NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

UHRF2 mRNA expression is low in malignant glioma but silencing inhibits the growth of U251 glioma cells in vitro
Wu TF, et al.
Asian Pacific Journal of Cancer Prevention, 13(10), 5137-5142 (2012)
Intra-nuclear degradation of polyglutamine aggregates by the ubiquitin proteasome system
Iwata A, et al.
The Journal of Biological Chemistry (2009)
Uhrf2 is important for DNA damage response in vascular smooth muscle cells
Luo T, et al.
Biochemical and Biophysical Research Communications, 441(1), 65-70 (2013)
Ubiquitin-like with PHD and ring finger domains 2 is a predictor of survival and a potential therapeutic target in colon cancer
Lu S, et al.
Oncology Reports, 31(4), 1802-1810 (2014)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique