Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Documents

SAB1400130

Sigma-Aldrich

Anti-HSD17B2 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Synonyme(s) :

Anti-EDH17B2, Anti-HSD17

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès UniProt

P37059

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HSD17B2(3294)

Description générale

HSD17B2 (Hydroxysteroid 17-ß dehydrogenase 2) is a member of the short chain alcohol dehydrogenase superfamily, expressed in non-steroidogenic human embryonic kidney cells.

Immunogène

HSD17B2 (NP_002144.1, 1 a.a. ~ 387 a.a) full-length human protein.

Sequence
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT

Actions biochimiques/physiologiques

HSD17B2 (Hydroxysteroid 17-β dehydrogenase 2) is highly involved in the synthesis and metabolism of steroid hormones. It maintains the intracellular concentration of biologically active steroid hormones in a wide range of male and female human tissues. It catalyzes the interconversion of testosterone and androstenedione as well as estradiol and estrone through 17-β HSD activities. HSD17B2 also of 20α-HSD activity towards 20α-dihydroprogesterone.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Frauke Beilstein et al.
PloS one, 8(1), e53017-e53017 (2013-01-10)
In enterocytes, the dynamic accumulation and depletion of triacylglycerol (TAG) in lipid droplets (LD) during fat absorption suggests that cytosolic LD-associated TAG contribute to TAG-rich lipoprotein (TRL) production. To get insight into the mechanisms controlling the storage/secretion balance of TAG
L Wu et al.
The Journal of biological chemistry, 268(17), 12964-12969 (1993-06-15)
17 beta-Hydroxysteroid dehydrogenase (17 beta-HSD) is an enzyme crucial to the regulation of intracellular levels of biologically active steroid hormones in a variety of tissues. Here, we report the isolation, structure, and characterization of a cDNA encoding the human 17

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique