HPA019880
Anti-CBLB antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-Casitas B-lineage lymphoma proto-oncogene b, Anti-E3 ubiquitin-protein ligase CBL-B, Anti-RING finger protein 56, Anti-SH3-binding protein CBL-B, Anti-Signal transduction protein CBL-B
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
recombinant expression
Learn more about Antibody Enhanced Validation
Technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL
Séquence immunogène
DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... CBLB(868)
Description générale
CBLB (Cbl proto-oncogene B) is an E3 ubiquitin protein ligase belonging to the CBL protein family. It is mapped to human chromosome 3q13.11. In mammals, there are three homologues of Cbl, namely c-Cbl, Cbl-b and Cbl-c. It is composed of highly conserved tyrosine kinase binding (TKB) domain and new gene (RING) finger catalytic domains.
Immunogène
E3 ubiquitin-protein ligase CBL-B recombinant protein epitope signature tag (PrEST)
Application
Anti-CBLB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Actions biochimiques/physiologiques
CBLB (Cbl proto-oncogene B) plays a crucial role in the regulation of immune cell activation. Both the domains perform different activities in ubiquitin ligase activity, such as TKB domain interacts directly with phosphorylated tyrosine-containing proteins through Src homology (SH) 2 domains and RING finger domain binds to E2 ubiquitin-conjugating. CBLB is phosphorylated upon T cell receptor (TCR) stimulation and is involved in TCR-mediated intracellular signaling pathways enzymes. Similarly, phosphorylated CBLB is recruited to epidermal growth factor receptor (EGFR) upon EGF stimulation and inhibits EGF-induced cell growth. CBLB participates in controlling T-cell activation thresholds by negative regulation of Vav, a GDP/GTP exchange factor. The molecular mechanism involves CBLB-mediated degradation of p85 regulatory subunit of phosphatidylinositol 3-kinase, an upstream regulator of Vav. CBLB is associated with an autoimmune disease of the central nervous system, multiple sclerosis.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST73955
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Tomoki Abe et al.
Endocrine journal, 61(6), 529-538 (2014-03-13)
Obesity causes type 2 diabetes, atherosclerosis and cardiovascular diseases by inducing systemic insulin resistance. It is now recognized that obesity is related to chronic low-grade inflammation in adipose tissue. Specifically, activated immune cells infiltrate adipose tissue and cause inflammation. There
Jezabel Varadé et al.
Multiple sclerosis (Houndmills, Basingstoke, England), 18(7), 959-965 (2011-12-24)
Ten genes previously showing different evidence of association with multiple sclerosis have been selected to validate. Eleven polymorphisms were genotyped with the iPLEX™ Sequenom in a well-powered collection of Spanish origin including 2863 multiple sclerosis cases and 2930 controls. Replication
S A Ettenberg et al.
Oncogene, 18(10), 1855-1866 (1999-03-23)
The role of cbl-b in signaling by the epidermal growth factor receptor (EGFR) was studied and compared with c-cbl. We demonstrate in vivo, that cbl-b, like c-cbl, is phosphorylated and recruited to the EGFR upon EGF stimulation and both cbl
D Fang et al.
The Journal of biological chemistry, 276(7), 4872-4878 (2000-11-23)
Cbl-b is implicated in setting the threshold of T lymphocyte activation. In Cbl-b-deficient T cells, the activation of Vav, a guanine nucleotide exchange factor, is significantly enhanced. The molecular mechanism underlying Cbl-b-regulated Vav activation was unclear. Here it is shown
C Elly et al.
Oncogene, 18(5), 1147-1156 (1999-02-18)
Cbl-b, a mammalian homolog of Cbl, consists of an N-terminal region (Cbl-b-N) highly homologous to oncogenic v-Cbl, a Ring finger, and a C-terminal region containing multiple proline-rich stretches and potential tyrosine phosphorylation sites. In the present study, we demonstrate that
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique