HPA015275

Anti-SLC30A1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Solute carrier family 30 member 1, Anti-Zinc transporter 1, Anti-ZnT-1
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA015275
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Séquence immunogène: HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGV
• Numéro d'accès UniProt: Q9Y6M5
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SLC30A1(7779)

Description

Description générale

SLC30A1 (solute carrier family 30, member 1) is a transmembrane transporter of the zinc-regulating family of proteins. It has a wide range of tissue expression, with predominant expression in brain, heart, pancreas and testis. It is the first ZnT (zinc transporter) family member to be identified, and the ZnT family in turn is a part of cation diffusion facilitator (CDF) family of proteins. This protein contains six transmembrane domains which are connected by histidine rich loops.

Immunogène

Zinc transporter 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

SLC30A1 (solute carrier family 30, member 1) is involved in the metabolism of zinc, and prevents cellular zinc toxicity. It is a newly recognized endogenous LTCC (L-type calcium channel)-inhibitor, where it interacts with the LTCCβ subunit. This prevents the transport of LTCCα1 subunit to the plasma membrane. In heart, the inhibition of LTCC affects the cardiac electrical remodeling post-atrial fibrillation. In brain, it influences the synaptic responses. It increases the surface expression and activity of T-type calcium channels such as, CaV3.1 and CaV3.2, by activating the Ras-ERK signaling pathway. Inactivation of this gene leads to death in early embryonic stage. It controls Ras-mediated signaling, by interacting with and activating Raf-1. The expression of this protein is abnormal in the brains of patients with mild cognitive impairment (MCI), and early and late stage Alzheimer′s disease (AD). Thus, pathogenesis of AD might be associated with aberrations in zinc homeostasis.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73291

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)