HPA014650

Anti-TMED9 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-HSGP25L2G, Anti-p24a2, Anti-p24alpha2
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA014650
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: rat, human
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHS
• Numéro d'accès UniProt: Q9BVK6
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TMED9(54732)

Description

Description générale

TMED9 (transmembrane emp24 protein transport domain containing 9) belongs to a family of widely present, small, type I transmembrane proteins called p24 proteins. This family can be divided into four subfamilies namely, p23 or δ, p24 or β, p25 or α, and p26 or γ. TMED9 is also called p25 and is the only member of the p25 subfamily in mammals. It localizes to endoplasmic reticulum and cis-Golgi network (CGN). Its C-terminal is small and faces the cytoplasm and contains degenerate sorting motifs. It has a coiled-coil domain in its extracellular domain. It also contains a KKXX ER-retrieval motif.

Immunogène

transmembrane p24 trafficking protein 9

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

TMED9 (transmembrane emp24 protein transport domain containing 9) is thought to play a role in the formation of ER (endoplasmic reticulum) exit sites and vesicular tubular clusters (VTCs). It controls the dynamic and composition of membrane by forming highly-specialized domains. It also ensures that Golgi-membranes are low on cholesterol, to maintain normal membrane transport. This gene has an extremely high expression level in the pituitary of obese mice, and this expression is down-regulated when treated with leptin. TMED9 interacts with T-cell protein tyrosine phosphatase (TC48), and localizes it to the ER, where TC48 normally resides. TMED9 acts as a cargo receptor that shuttles between Golgi complex and the ER, and it also interacts with syntaxin 17. Syntaxin 17 is important for the maintenance of ERGIC (ER-Golgi intermediate compartment) and Golgi architecture.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72987

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)