AV46751

Anti-VAMP5 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Vesicle-associated membrane protein 5 (Myobrevin)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 13 kDa
• Espèces réactives: human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_006625
• Numéro d'accès UniProt: O95183
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... VAMP5(10791)

Description

Immunogène

Synthetic peptide directed towards the middle region of human VAMP5

Application

Anti-VAMP5 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Actions biochimiques/physiologiques

VAMP5 (vesicle-associated membrane protein 5) gene encodes a 116 amino acid containing single-pass type IV membrane protein that belongs to the synaptobrevin family and the SNARE superfamily. It plays a pivotal role vesicle trafficking events that are associated with myogenesis like- myoblast fusion and/or GLUT4 trafficking. VAMP5 protein is localized in skeletal muscle, heart, spleen, lung, liver, and kidney tissue and facilitates the membrane trafficking in skeletal and cardiac muscle.

Séquence

Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable