AV35126

Anti-KCNAB1 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Potassium voltage-gated channel, shaker-related subfamily, β member 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 46 kDa
• Espèces réactives: rat, dog, bovine, mouse, human, rabbit, guinea pig, horse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_003462
• Numéro d'accès UniProt: Q14722
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... KCNAB1(7881)

Description

Description générale

KCNAB1 codes for a member of potassium voltage-gated channel (shaker-related) protein subfamily. KCNAB1 forms a β subunit and associates with α subunits to form heteromeric complexes that modulate pore formation. Genetic variations in KCNAB1 have been linked to lateral temporal epilepsy.
Rabbit Anti-KCNAB1 antibody recognizes rabbit, canine, human, mouse, rat, chicken, pig, bovine, and zebrafish KCNAB1.

Immunogène

Synthetic peptide directed towards the C terminal region of human KCNAB1

Application

Rabbit Anti-KCNAB1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNAB1 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily.

Séquence

Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable