AV34382

Anti-NFKBIB antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, β
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 38 kDa
• Espèces réactives: rabbit, mouse, human, rat, guinea pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_002494
• Numéro d'accès UniProt: Q15653
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... NFKBIB(4793)

Description

Description générale

NFKBIB is a NF-κB inhibitor that forms a complex with NF-κB and traps it in the cytoplasm. Serine phosphorylation in NFKBIB proteins activates its ubiquitin-mediated degradation. This subsequently facilitates the nuclear transport and functions of NF-κB proteins.
Rabbit Anti-NFKBIB antibody recognizes human, mouse, rat, canine, and bovine NFKBIB.

Immunogène

Synthetic peptide directed towards the N terminal region of human NFKBIB

Application

Rabbit Anti-NFKBIB antibody can be used for western blot applications at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].

Séquence

Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable