WH0054659M2
Monoclonal Anti-UGT1A3 antibody produced in mouse
clone 1C10, purified immunoglobulin, buffered aqueous solution
Sinônimo(s):
Anti-UDP glucuronosyltransferase 1 family, polypeptide A3, Anti-UGT1*3, Anti-UGT1C
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
mouse
conjugado
unconjugated
forma do anticorpo
purified immunoglobulin
tipo de produto de anticorpo
primary antibodies
clone
1C10, monoclonal
forma
buffered aqueous solution
reatividade de espécies
human
técnica(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotipo
IgG2bκ
nº de adesão GenBank
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
Informações sobre genes
human ... UGT1A3(54659)
Descrição geral
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5′ exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. Substrates of this enzyme include estrone, 2-hydroxyestrone, and metabolites of benzo alpha-pyrene. (provided by RefSeq)
Imunogênio
UGT1A3 (NP_061966, 30 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV
Sequence
KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV
forma física
Solution in phosphate buffered saline, pH 7.4
Informações legais
GenBank is a registered trademark of United States Department of Health and Human Services
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
nwg
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Anne Marthe Fosdahl et al.
Biochimica et biophysica acta, 1864(12), 2241-2252 (2017-09-05)
The ErbB family of receptor tyrosine kinases mediates activation of a wide network of signaling pathways. ErbB3 has weak kinase activity, but its six docking sites for the p85 subunit of phosphoinositide 3-kinase make it an important contributor to proliferative
Heejin Kim et al.
Oral surgery, oral medicine, oral pathology and oral radiology, 129(4), 377-387 (2020-02-23)
We aimed to identify the prognostic factors in head and neck squamous cell carcinoma (HNSCC) by using gene expression analysis and candidate biomarkers for adjuvant therapy. Complementary DNA (cDNA) microarray analysis was performed by using samples from 8 patients, who
Umamaheswar Duvvuri et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 25(19), 5752-5758 (2019-07-17)
ErbB3 and its ligand neuregulin-1 (NRG1) are widely expressed in head and neck squamous cell carcinoma (HNSCC) and associated with tumor progression. A "window-of-opportunity" study (NCT02473731) was conducted to evaluate the pharmacodynamic effects of CDX-3379, an anti-ErbB3 mAb, in patients
Vincent P Walter et al.
Breast cancer research and treatment, 169(2), 305-309 (2018-01-29)
The 70-gene signature (70-GS) is a prognostic tool, grouping patients in risk groups to assess their need for adjuvant chemotherapy. Tumor cell dissemination to the bone marrow is a marker of minimal residual disease and associated with impaired survival. In
Ahmad Salameh et al.
Oncotarget, 8(4), 6526-6539 (2016-12-31)
Here we report that the lncRNA LINC00052 expression correlates positively with HER3/ErbB3 levels in breast cancer cells. Gene silencing of LINC00052 diminished both LINC00052 and HER3 expression and reduced cancer cell growth in vitro and in vivo. LINC00052 overexpression promoted
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica