Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

WH0004857M7

Sigma-Aldrich

Monoclonal Anti-NOVA1 antibody produced in mouse

clone 3F3, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-Nova1, Anti-neuro-oncological ventral antigen 1

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3F3, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human, rat, mouse

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... NOVA1(4857)

Descrição geral

Neuro-oncological ventral antigen 1 (NOVA1) is expressed in fibroblasts. It is part of the Nova family of neuron-specific RNA-binding proteins. The NOVA1 gene is localized on human chromosome 14q12.

Imunogênio

NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

Ações bioquímicas/fisiológicas

NOVA1(Neuro-oncological ventral antigen 1) is associated with several post-transcriptional regulation of RNA metabolism including RNA splicing, editing to transport, localization, and degradation. It may be involved in mediating neuronal responsiveness. It encodes a protein which has homology with the RNA-binding protein hnRNP K, the yeast splicing protein MER1. Since, it has some homology with hnRNP K, it may influence the regulation of RNA splicing or metabolism in developing neurons. The importance of NOVA1 as prognostic marker has been reported in HCC (Hepatocellular carcinoma). Alteration in gene causes a disorder associated with breast cancer and motor dysfunction i.e. paraneoplastic opsoclonus myoclonus ataxia (POMA).

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

12 - Non Combustible Liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

14q12 and severe Rett-like phenotypes: new clinical insights and physical mapping of FOXG1-regulatory elements
Lila Allou
European Journal of Human Genetics (2012)
Implications of NOVA1 suppression within the microenvironment of gastric cancer: association with immune cell dysregulation.
Kim EK
Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association (2017)
MiR-181b-5p downregulates NOVA1 to suppress proliferation, migration and invasion and promote apoptosis in astrocytoma.
Zhi F
PLoS ONE (2014)
R J Buckanovich et al.
Neuron, 11(4), 657-672 (1993-10-01)
Paraneoplastic opsoclonus-ataxia, a disorder of motor control, develops in breast or lung cancer patients who harbor an antibody (Ri) that recognizes their tumors and a nuclear neuronal protein of 55 kd. We have characterized a gene, Nova, encoding an antigen
Mylène Hervé et al.
Disease models & mechanisms, 9(8), 899-909 (2016-08-03)
Familial dysautonomia (FD) is a rare neurodegenerative disease caused by a mutation in intron 20 of the IKBKAP gene (c.2204+6T>C), leading to tissue-specific skipping of exon 20 and a decrease in the synthesis of the encoded protein IKAP (also known

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica