SAB5702101

Anti-Integrin alpha 6 (ITGA6/CD49f) Antibody, clone 2R5F1, Rabbit Monoclonal

• Sinônimo(s): CD49f,ITGA6B,VLA-6,Integrin alpha 6,ITGA6
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 2R5F1, monoclonal
• forma: liquid
• peso molecular: 125 kDa
• reatividade de espécies: rat, rat, human
• concentração: 1 mg/mL
• técnica(s): flow cytometry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP
• nº de adesão UniProt: P23229
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ITGA6(3655)

Descrição

Descrição geral

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Imunogênio

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 481-591 of human Integrin alpha 6 (ITGA6/CD49f) (NP_001073286.1).

Aplicação

WB, FC

Informações de segurança

• Pictogramas: GHS07,GHS09
• Palavra indicadora: Warning
• Frases de perigo: H317,H411
• Declarações de precaução: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classificações de perigo: Aquatic Chronic 2 - Skin Sens. 1
• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3