SAB2109233

Anti-APBB1 (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): APBB1, FE65, RIR
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 78 kDa
• reatividade da espécie (prevista por homologia): human
• concentração: 0.5 mg/mL
• técnica(s): western blot: 1 μg/mL
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... APBB1(57396)

Descrição

Descrição geral

The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer′s disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product′s nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer′s disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Imunogênio

Synthetic peptide directed towards the N-terminal region of Human APBB1

Sequência

Synthetic peptide located within the following region: QALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDS

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable