SAB2108809

Anti-PXDN (N-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• Sinônimo(s): EIF3S2, PRO2242, TRIP-1, TRIP1, eIF3-beta
• Código UNSPSC: 12352203
• NACRES: NA.45

Propriedades

• fonte biológica: rabbit
• conjugado: peroxidase conjugate
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 79 kDa
• reatividade da espécie (prevista por homologia): horse, mouse, guinea pig, human, rabbit, rat, canine
• concentração: 0.5 mg/mL
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PXDN(7837)

Descrição

Descrição geral

Drosophila peroxidasin is an extracellular matrix-associated peroxidase (Horikoshi et al., 1999 [PubMed 10441517]). It is expressed exclusively in hemocytes derived from head mesoderm at a very early stage of differentiation. Peroxidasin exists as a homotrimer with a unique hybrid structure that combines an enzymatically functional peroxidase domain with motifs that are typically found in extracellular matrix-associated proteins. It is a secreted protein that contains a secretory recognition sequence at its N terminus. Peroxidasin catalyzes hydrogen peroxide-driven radioiodination, oxidations, and the formation of dityrosine in vitro. It is also thought to function in extracellular matrix consolidation, phagocytosis, and defense.

Imunogênio

Synthetic peptide directed towards the N-terminal region of Human PXDN

Sequência

Synthetic peptide located within the following region: NLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKL

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable