HPA003162

Anti-LGALS3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-35 kDa lectin antibody produced in rabbit, Anti-CBP 35 antibody produced in rabbit, Anti-Carbohydrate-binding protein 35 antibody produced in rabbit, Anti-GALBP antibody produced in rabbit, Anti-Galactose-specific lectin 3 antibody produced in rabbit, Anti-Galactoside-binding protein antibody produced in rabbit, Anti-Galectin-3 antibody produced in rabbit, Anti-IgE-binding protein antibody produced in rabbit, Anti-L-31 antibody produced in rabbit, Anti-Laminin-binding protein antibody produced in rabbit, Anti-Lectin L-29 antibody produced in rabbit, Anti-Mac-2 antigen antibody produced in rabbit
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA003162
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• sequência de imunogênio: SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVK
• nº de adesão UniProt: P17931
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... LGALS3(3958)

Descrição

Descrição geral

LGALS3 (lectin, galactoside-binding, soluble, 3) gene encodes a galactose-specific lectin called ′Galectin-3′ that belongs to the galectin family of carbohydrate binding proteins. It has a molar mass of approximately 30kDa and may be localized to the extracellular matrix, the cytoplasm and the nucleus. It has a proline- and glycine-rich NH(2)-terminal domain that is fused to a single C-terminal domain that binds to galactose-containing glycoconjugates.

Imunogênio

Galectin-3 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

Galectin-3 functions in acute inflammation, chronic inflammation and tissue fibrogenesis and may serve as a potential therapeutic target in the treatment of various inflammatory diseases. It forms a complex with NG2 proteoglycan and alpha3beta1 integrin on the cell surface and promotes endothelial cell motility and morphogenesis during early stages of neovascularization. It associates with Bcl-2, an apoptosis repressor in the cytoplasm and exhibit anti-apoptotic activity. Gal-3 also serves as a pre-mRNA splicing factor by interacting with the U1 small nuclear ribonucleoprotein (snRNP) complex. It is found to be involved in the progression and metastasis of several types of tumors. It is found to participate in the regulation of T-cell functions.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70617

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)