Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

AV48378

Sigma-Aldrich

Anti-OCIAD1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Asrij, Anti-FLJ20455, Anti-MGC111072, Anti-OCIA, Anti-OCIA domain containing 1, Anti-TPA018

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

27 kDa

reatividade de espécies

guinea pig, horse, human, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_001073308

nº de adesão UniProt

Q9NX40

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... OCIAD1(54940)

Descrição geral

OCIAD1 codes for an OCIA domain-containing protein that is involved in ovarian cancer cell adhesion. Its expression in differentiated thyroid carcinoma has been correlated to metastasis risk.
Rabbit Anti-OCIAD1 antibody recognizes canine, bovine, human, mouse, and rat OCIAD1.

Imunogênio

Synthetic peptide directed towards the C terminal region of human OCIAD1

Aplicação

Rabbit Anti-OCIAD1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Ações bioquímicas/fisiológicas

OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer. Effect of OCIAD1 on cell adhesion may be related to its function in ovarian cancer. Possibily, OCIAD1 may play a role in tumor metastasis.

Sequência

Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Saubhik Sengupta et al.
Gynecologic oncology, 109(2), 226-233 (2008-03-11)
To identify proteins unique to metastatic ovarian cancer and test their potential involvement in cell adhesion. We purified plasma membrane from paired metastatic and primary tumor tissues from patients with stage IIIC ovarian cancer. Membrane proteins unique to metastases were
An-Hang Yang et al.
Journal of clinical pathology, 65(3), 206-212 (2011-11-15)
The biomarkers representing the metastatic potential of well-differentiated thyroid carcinoma remain to be established. A study was undertaken to find whether the expression status of neural cell adhesion molecule (NCAM) and/or ovarian cancer immunoreactive antigen domain containing 1 (OCIAD1) is

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica