AV46751

Anti-VAMP5 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Vesicle-associated membrane protein 5 (Myobrevin)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 13 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_006625
• nº de adesão UniProt: O95183
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... VAMP5(10791)

Descrição

Imunogênio

Synthetic peptide directed towards the middle region of human VAMP5

Aplicação

Anti-VAMP5 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Ações bioquímicas/fisiológicas

VAMP5 (vesicle-associated membrane protein 5) gene encodes a 116 amino acid containing single-pass type IV membrane protein that belongs to the synaptobrevin family and the SNARE superfamily. It plays a pivotal role vesicle trafficking events that are associated with myogenesis like- myoblast fusion and/or GLUT4 trafficking. VAMP5 protein is localized in skeletal muscle, heart, spleen, lung, liver, and kidney tissue and facilitates the membrane trafficking in skeletal and cardiac muscle.

Sequência

Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable