AV46227

Anti-NCAPH antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-BRRN1, Anti-CAP-H, Anti-HCAP-H, Anti-Non-SMC condensin I complex, subunit H
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 82 kDa
• reatividade de espécies: dog, human, mouse, rabbit, rat, pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_056156
• nº de adesão UniProt: Q15003
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NCAPH(23397)

Descrição

Imunogênio

Synthetic peptide directed towards the C terminal region of human NCAPH

Aplicação

Anti-NCAPH antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Ações bioquímicas/fisiológicas

NCAPH (Non-SMC condensin I complex, subunit H) also referred to as HCAP-H, BRRN1 or CAPH belongs to barr gene family and is a regulatory subunit of the condensin complex. It facilitates the conversion of interphase chromatin into mitotic-like condense chromosomes. Caspase-3 gets stimulated and cleaves Cap-H, a subunit of condensin I during prolonged mitotic arrest. This leads to a loss of condensin I complex at the chromosomes and alters the chromosomal integrity. Subsequently DNA fragmentation occurs by caspase-activated Dnase (CAD) that drives the cell towards mitotic death. Additionally, it facilitates for the structural integrity of centromeric heterochromatin during mitosis.

Sequência

Synthetic peptide located within the following region: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable