Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos

AV44142

Sigma-Aldrich

Anti-SLC39A5 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-LZT-Hs7, Anti-MGC34778, Anti-Solute carrier family 39 (metal ion transporter), member 5, Anti-ZIP5

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(6)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

56 kDa

reatividade de espécies

mouse, human, rat, rabbit

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_775867

nº de adesão UniProt

Q6ZMH5

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SLC39A5(283375)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the N terminal region of human SLC39A5

Aplicação

Anti-SLC39A5 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

SLC39A5 (ZIP5) is a zinc uptake transporter that specifically transports Zn+2 ions. It is expressed in intestine, pancreas, liver and kidney. ZIP5 maintains zinc homeostasis and plays an important role in the uptake of dietary zinc across apical membrane of enterocytes in the intestine. Zinc transport by ZIP5 is important to protect the pancreatic acinar cells against zinc toxicity.

Sequência

Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Jim Geiser et al.
PloS one, 8(11), e82149-e82149 (2013-12-05)
ZIP5 localizes to the baso-lateral membranes of intestinal enterocytes and pancreatic acinar cells and is internalized and degraded coordinately in these cell-types during periods of dietary zinc deficiency. These cell-types are thought to control zinc excretion from the body. The
Benjamin P Weaver et al.
Biometals : an international journal on the role of metal ions in biology, biochemistry, and medicine, 25(2), 319-335 (2011-11-25)
Translation of the basolateral zinc transporter ZIP5 is repressed during zinc deficiency but Zip5 mRNA remains associated with polysomes and can be rapidly translated when zinc is repleted. Herein, we examined the mechanisms regulating translation of Zip5. The 3'-untranslated region
Fudi Wang et al.
The Journal of biological chemistry, 279(49), 51433-51441 (2004-08-24)
The mouse and human Zip5 proteins are members of the ZIP family of metal ion transporters. In this study, we present evidence that mouse Zip5 is a zinc uptake transporter that is specific for Zn(II) over other potential metal ion

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica