AV42101

Anti-SQLE antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-FLJ30795, Anti-Squalene epoxidase
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 39 kDa
• reatividade de espécies: human, bovine, rabbit, mouse, sheep
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_003120
• nº de adesão UniProt: Q14534
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SQLE(6713)

Descrição

Descrição geral

Squalene epoxidase (SQLE) is an NADPH-dependent flavoprotein monooxygenase that oxidizes squalene to 2,3,-oxidosqualene (squalene epoxide) which is the first oxygenation and rate-limiting step in sterol, ergosterol and cholesterol, biosynthesis.

Especificidade

Anti-SQLE polyclonal antibody reacts with human, mouse, rat, pig, zebrafish, bovine, and canine squalene epoxidases.

Imunogênio

Synthetic peptide directed towards the C terminal region of human SQLE

Aplicação

Anti-SQLE polyclonal antibody is used to tag squalene epoxidase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of squalene epoxidase in sterol, ergosterol and cholesterol, biosynthesis.

Ações bioquímicas/fisiológicas

Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.

Sequência

Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable