SAB2100123

Anti-ANP32B antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-APRIL, Anti-Acidic (leucine-rich) nuclear phosphoprotein 32 family, member B, Anti-PHAPI2, Anti-SSP29
• MDL number: MFCD04974671
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 29 kDa
• species reactivity: horse, rat, guinea pig, sheep, bovine, rabbit, dog, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q92688
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ANP32B(10541)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human ANP32B

Biochem/physiol Actions

ANP32B is a multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. ANP32B is required for the progression from the G1 to the S phase. ANP32B is an anti-apoptotic protein which functions as a caspase-3 inhibitor. It has no phosphatase 2A (PP2A) inhibitor activity.

Sequence

Synthetic peptide located within the following region: GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable