Skip to Content
Merck
All Photos(1)

Documents

HPA038730

Sigma-Aldrich

Anti-NEU3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-sialidase 3 (membrane sialidase)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

LSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQT

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NEU3(10825)

General description

NEU3 sialidase also called neuraminidase, is an enzyme located on the outer leaflet of plasma membrane, which catalyses the removal of sialic acids present on the gangliosides thus providing cell to cell interactions. The NEU3 sialidase gene is located on human chromosome 11q 13s.5 and this protein consists of 428 amino acids.

Immunogen

sialidase 3 (membrane sialidase) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

NEU3 sialidase regulates neuronal differentiation, apoptosis and adhesion. Neu3 sialidase helps cell differentiation, carcinogenesis and mediates cellular response to hypoxic stress. NEU3 sialidase directly interacts with and regulates epidermal growth factor receptor (EGFR).Overexpression of NEU3 sialidase stimulates extracellular regulated kinase (ERK) and protein kinase B (AKT/PKB) pathways, which is inhibited or decreased by gefitinib treatment respectively. NEU3 sialidase invades glioblastoma cells by regulating calpain activity and disassembly of focal adhesion. Many types of cancers like colon and prostate carcinomas exhibit an upregulation of NEU3.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80678

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Non-small cell lung cancer (NSCLC), EGFR downstream pathway activation and TKI targeted therapies sensitivity: Effect of the plasma membrane-associated NEU3
Forcella,, et al.
Testing, 12(10), e0187289-e0187289 (2017)
Mammalian sialidases: physiological and pathological roles in cellular functions
Miyagi, T, et al.
Glycobiology, 22(7), 880-896 (2012)
Sialidase NEU3 defines invasive potential of human glioblastoma cells by regulating calpain-mediated proteolysis of focal adhesion proteins
Takahashi, et al.
Biochimica et biophysica acta. General subjects, 1861(11), 2778-2788 (2017)
NEU3 sialidase protein interactors in the plasma membrane and in the endosomes
Cirillo,, et al.
The Journal of Biological Chemistry, 291(20), 10615-10624 (2016)
Increased sialidase activity in serum of cancer patients: Identification of sialidase and inhibitor activities in human serum
Hata, Kei, et al.
Cancer Science, 106(4), 383-389 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service