Accéder au contenu
Merck
Toutes les photos(2)

Documents

SAB1412264

Sigma-Aldrich

ANTI-SP1 antibody produced in mouse

clone 1G9, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

SP1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1G9, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 36.41 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SP1(6667)

Description générale

Sp1 protein was the first transcription factor to be cloned and characterized. It was first detected in HeLa cells on the basis of its ability to activate the SV40 early promoter transcription. Analysis of structure and function has revealed that Sp1 can be separated into discrete functional domains. The DNA-binding domain consists of three zinc fingers that specifically bind to the GC-box element.

Immunogène

SP1 (NP_612482, 522 a.a. ~ 618 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*

Actions biochimiques/physiologiques

Sp1 protein was shown to recognize and bind selectively to a GC-rich consensus sequence (GC-box: GGGCGG or CACCC) that presents in the promoter of several important cellular genes, including Simian vacuolating virus 40 (SV40) early, human immunodeficiency virus-1 (HIV-1), platelet-derived growth factor subunit B (PDGF-B), Myc, c-Src etc. In addition to transcription, Sp1 function has been linked to cell growth, cancer and Huntington disease.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Structures of zinc finger domains from transcription factor Sp1. Insights into sequence-specific protein-DNA recognition.
Narayan VA
The Journal of Biological Chemistry, 272(12), 7801-7809 (1997)
Mithramycin is a gene-selective Sp1 inhibitor that identifies a biological intersection between cancer and neurodegeneration.
Sleiman SF
The Journal of Neuroscience, 31(18), 6858-6870 (2011)
Decreased association of the transcription factor Sp1 with genes downregulated in Huntington's disease.
Chen-Plotkin AS
Neurobiology of Disease, 22(2), 233-241 (2006)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique