HPA010817

Anti-FXYD5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Dysadherin, Anti-FXYD domain-containing ion transport regulator 5 precursor
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA010817
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Séquence immunogène: DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR
• Numéro d'accès UniProt: Q96DB9
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FXYD5(53827)

Description

Description générale

FXYD5 (FXYD domain containing ion transport regulator 5) is a cancer-associated glycoprotein localized to the cell surface. It belongs to the family of FXYD proteins, which interacts with and modulate Na,K-ATPase. These proteins span the cell membrane once. The cDNA for this gene codes for a protein of 178 amino acids, containing a single transmembrane domain, a short cytoplasmic tail. It also has a putative O-glycosylated extracellular region as well as a signal peptide. This gene is present with the human chromosome locus 19q13.12. Under normal conditions, it is expressed in only specific tissues. These are generally epithelial tissues such as, lung, kidney and intestine. It is also expressed in normal lymphocytes, as well as in stratified squamous epithelia, in the basal and endothelial cells.

Immunogène

FXYD domain-containing ion transport regulator 5 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

FXYD5 (FXYD domain containing ion transport regulator 5) is responsible for transcriptionally down-regulating E-cadherin. Therefore, it facilitates tumor invasiveness and metastasis. It is suggested that FXYD5 interacts with actin, and has a role in the formation of microvilli. It is expressed in a wide range of cancer, such as breast, stomach, pancreatic and colon. It is also expressed in head and neck squamous cell carcinoma. It is also expressed in testis, epididymis and ejaculated sperms. In the ejaculated spermatozoa, it co-localizes with E-cadherin and Na,K-ATPase, and therefore, might be a regulator of sperm function. FXYD5 might have potential to determine the prognosis of disease-free survival in stage I NSCLC patients. Its expression level correlates to the risk level of gastrointestinal stromal tumors (GISTs), and thus, may be used for the prognosis of GISTs.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71700

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)