Accéder au contenu
Merck
Toutes les photos(7)

Documents

HPA002111

Sigma-Aldrich

ANTI-KDM6A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-UTX, Anti-Ubiquitously transcribed TPR protein on the X chromosome, Anti-Ubiquitously transcribed X chromosome tetratricopeptide repeat protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(7)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA002111
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... UTX(7403)

Catégories apparentées

Description générale

Lysine-specific demethylase 6A (KDM6A) is a tumor suppressor gene mapped to human chromosome Xp11.3. The gene codes for histone H3 lysine 27 (H3K27) demethylase, which is a member of the switch/sucrose non-fermentable (SWI/SNF) family.

Immunogène

Ubiquitously transcribed X chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the X chromosome)

Sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT

Application

ANTI-KDM6A antibody produced in rabbit has been used in western blotting and immunoprecipitation.

Actions biochimiques/physiologiques

Lysine-specific demethylase 6A (KDM6A) counteracts zeste homolog 2 (EZH2) function and induces tumor suppression by stimulating gene transcription of E-cadherin, cell cycle regulators and tumor-suppressing subchromosomal transferable fragments. It also eliminates trimethylation marks from histone 3 lysine 27 (H3K27) and supports histone demethylase activity through its catalytic JmjC domain. Mutation in the gene leads to the development of a rare congenital anomaly syndrome, Kabuki syndrome (KS).

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST85171

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Histone demethylase KDM6A controls the mammary luminal lineage through enzyme-independent mechanisms
Yoo K, et al.
Molecular and Cellular Biology, 36(16), 2108-2120 (2016)
Novel KDM6A splice-site mutation in kabuki syndrome with congenital hydrocephalus: a case report
Guo Z, et al.
BMC Medical Genetics, 19(1), 206-206 (2018)
Inhibition of EZH2 induces NK cell-mediated differentiation and death in muscle-invasive bladder cancer
Ramakrishnan S, et al.
Cell Death and Differentiation, 26(10), 2100-2114 (2019)
Epigenetic regulation of epithelial-mesenchymal transition by KDM6A histone demethylase in lung cancer cells
Terashima M, et al.
Biochemical and Biophysical Research Communications, 490(4), 1407-1413 (2017)
Kyung Hyun Yoo et al.
Molecular and cellular biology, 36(16), 2108-2120 (2016-05-25)
Establishment of the mammary luminal cell lineage is controlled primarily by hormones and through specific transcription factors (TFs). Previous studies have linked histone methyltransferases to the differentiation of mammary epithelium, thus opening the possibility of biological significance of counteracting demethylases.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique