Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV44366

Sigma-Aldrich

Anti-PPIB (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-CYP-S1, Anti-CYPB, Anti-MGC14109, Anti-MGC2224, Anti-Peptidylprolyl isomerase B (cyclophilin B), Anti-SCYLP

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

24 kDa

Espèces réactives

human, horse, rabbit, mouse, dog, bovine, rat, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_000933

Numéro d'accès UniProt

A8K534

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... PPIB(5479)

Immunogène

Synthetic peptide directed towards the C terminal region of human PPIB

Application

Anti-PPIB (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

Peptidylprolyl isomerase B (PPIB; cyclophilin B) is a protein released with secretory pathway in the biological fluids by the rough endoplasmic reticulum. It is involved in the regulation of cyclosporine A-mediated immunosuppression. Mutations in the PPIB gene cause a delay in procollagen chain association in osteoblasts that is one of the features of osteogenesis imperfecta phenotypes.

Séquence

Synthetic peptide located within the following region: VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Aileen M Barnes et al.
The New England journal of medicine, 362(6), 521-528 (2010-01-22)
Osteogenesis imperfecta is a heritable disorder that causes bone fragility. Mutations in type I collagen result in autosomal dominant osteogenesis imperfecta, whereas mutations in either of two components of the collagen prolyl 3-hydroxylation complex (cartilage-associated protein [CRTAP] and prolyl 3-hydroxylase
Fleur S van Dijk et al.
American journal of human genetics, 85(4), 521-527 (2009-09-29)
Deficiency of cartilage-associated protein (CRTAP) or prolyl 3-hydroxylase 1(P3H1) has been reported in autosomal-recessive lethal or severe osteogenesis imperfecta (OI). CRTAP, P3H1, and cyclophilin B (CyPB) form an intracellular collagen-modifying complex that 3-hydroxylates proline at position 986 (P986) in the
Shawna M Pyott et al.
Human molecular genetics, 20(8), 1595-1609 (2011-02-02)
Recessive mutations in the cartilage-associated protein (CRTAP), leucine proline-enriched proteoglycan 1 (LEPRE1) and peptidyl prolyl cis-trans isomerase B (PPIB) genes result in phenotypes that range from lethal in the perinatal period to severe deforming osteogenesis imperfecta (OI). These genes encode
Jie Qing et al.
PLoS pathogens, 10(10), e1004422-e1004422 (2014-10-03)
Viruses utilize host factors for their efficient proliferation. By evaluating the inhibitory effects of compounds in our library, we identified inhibitors of cyclophilin A (CypA), a known immunosuppressor with peptidyl-prolyl cis-trans isomerase activity, can significantly attenuate EV71 proliferation. We demonstrated

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique